PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C00721.1.p
Common NameEUGRSUZ_C00721, LOC104436342
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 301aa    MW: 33903.4 Da    PI: 9.4764
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C00721.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.3e-151461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT  Ed++l  ++k +G g W+  +++ g++R++k+c++rw++yl
  Eucgr.C00721.1.p 14 RGAWTVMEDKILTSYIKAHGEGKWRNLPKRAGLKRCGKSCRLRWLNYL 61
                      89********************************************97 PP

2Myb_DNA-binding513.4e-1667111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+ + +E+el+++++k+lG++ W++Ia +++ gRt++++k++w++ 
  Eucgr.C00721.1.p  67 RGNISLDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTT 111
                       788999****************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-22564IPR009057Homeodomain-like
PROSITE profilePS5129413.807961IPR017930Myb domain
SuperFamilySSF466891.95E-2712108IPR009057Homeodomain-like
SMARTSM007171.3E-121363IPR001005SANT/Myb domain
PfamPF002491.8E-131461IPR001005SANT/Myb domain
CDDcd001672.40E-91661No hitNo description
PROSITE profilePS5129424.85162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-2465116IPR009057Homeodomain-like
SMARTSM007173.8E-1566114IPR001005SANT/Myb domain
PfamPF002494.1E-1467111IPR001005SANT/Myb domain
CDDcd001672.45E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGRSPCCSKE GMNRGAWTVM EDKILTSYIK AHGEGKWRNL PKRAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SLDEEELIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT TLGKKLAKTD  120
RSSSSPPSLK DINHPSSKSR SKRPVSKSSC LFPTKATRPR VTRYKPLEGT KVHASPGSSL  180
PSKNQSLYSI TQEYPPYLQA NYRPSGSTCQ QGLDSESPRS HRVHCGAHDD HLQKNFVGDF  240
GLINFGYGDE FNAANVMCAD QPLTVEQEML ENWTASFCVE EKDTLDLDSL AYLLNSEEWP  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C00721.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010047389.10.0PREDICTED: transcription factor MYB23-like
TrEMBLA0A059CLE40.0A0A059CLE4_EUCGR; Uncharacterized protein
STRINGVIT_04s0008g01800.t019e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.18e-62myb domain protein 7